SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only.

Product Info Summary

SKU: RCOV03
Size: 100μg/vial
Origin Species: Mouse
Source: E. coli

Product Name

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag

SKU/Catalog Number

RCOV03

Size

100μg/vial

Description

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only. Product is under validation for additional applications and indications. If you're interested, please contact [email protected].

Storage & Handling

The product is shipped at ambient temperature. Upon receipt, store it immediately at -20˚C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Cite This Product

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag (Boster Biological Technology, Pleasanton CA, USA, Catalog # RCOV03)

Form

Lyophilized

Formulation

Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose

Purity

> 90%. Purification measurement method by SDS-PAGE quantitative densitometry by Coomassie® Blue Staining.
Method of purification: Nickel column affinity purification

Predicted MW

13.2KD

Endotoxin

Less than 1 EU/μg protein as determined by LAL method

Expression Form

In supernatant

Amino Acid Sequence

6×His tag at C-terminal
Accession #: YP_009725305
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Background

Coronaviruses (CoV) are a family of large and enveloped positive-sense single-stranded RNA viruses that are classified into four genera, the alpha, beta, gamma, and delta coronaviruses. While gamma and delta coronaviruses mainly infect birds, alpha and beta coronaviruses are known to infect mammals and cause human respiratory illnesses such as the common cold, pneumonia, and severe diseases like SARS, MERS, and COVID-19. Coronavirus nucleoproteins localize to the cytoplasm and the nucleolus, a subnuclear structure, in both virus-infected primary cells and in cells transfected with plasmids that express N protein. Coronavirus N protein is required for coronavirus RNA synthesis, and has RNA chaperone activity that may be involved in template switch. Nucleocapsid protein is the most abundant protein of coronavirus. During virion assembly, the N protein binds to viral RNA and leads to the formation of the helical nucleocapsid. Nucleocapsid protein is a highly immunogenic phosphoprotein also implicated in viral genome replication and in modulating cell signaling pathways. Because of the conservation of N protein sequence and its strong immunogenicity, the N protein of coronavirus is chosen as a diagnostic tool.

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Hello CJ!

No publications found for RCOV03

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag

Size

Total: $250

SKU:RCOV03

Backordered.

Lead time for this item is typically 2-3 weeks

Get A Quote
In stock
Order Product
RCOV03
$250.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.